Antibodies

Jump to Filters
View as table Download
p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody
TA306110

USD 430.00

In Stock

Rabbit Polyclonal p53DINP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53DINP1 antibody was raised with a synthetic peptide corresponding to 14 amino acids near the amino terminus of human p53DINP1.
p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody
TA313400

USD 345.00

In Stock

Rabbit polyclonal anti-TP53INP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TP53INP1.
p53 DINP1 (TP53INP1) (C-term) Rabbit Polyclonal Antibody
AP54339PU-N

USD 450.00

2 Weeks

p53 DINP1 (TP53INP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 188-218 amino acids from the C-terminal region of human TP53INP1
p53 DINP1 (TP53INP1) (N-term) Rabbit Polyclonal Antibody
AP54340PU-N

USD 450.00

2 Weeks

p53 DINP1 (TP53INP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 43-72 amino acids from the N-terminal region of human TP53INP1
p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody
TA329163

USD 375.00

2 Weeks

Rabbit Polyclonal anti-TP53INP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53INP1 antibody: synthetic peptide directed towards the C terminal of human TP53INP1. Synthetic peptide located within the following region: SFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQ
p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody
TA351485

USD 345.00

In Stock

Rabbit Polyclonal Anti-TP53INP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TP53INP1
p53 DINP1 (TP53INP1) Rabbit Polyclonal Antibody
TA382738

USD 220.00

3 Weeks

p53 DINP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1).
Modifications Unmodified