Antibodies

Jump to Filters
View as table Download
Tpbg Rabbit Polyclonal Antibody
TA342297

USD 375.00

5 Days

Rabbit Polyclonal Anti-Tpbg Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tpbg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tpbg. Synthetic peptide located within the following region: GDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAER
5T4 (TPBG) Rabbit Polyclonal Antibody
TA382745

USD 220.00

3 Weeks

5T4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-350 of human 5T4 (NP_006661.1).
Modifications Unmodified