Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TPD54 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPD54 Antibody: A synthesized peptide derived from human TPD54 |
Antibodies
View as table Download
Goat Polyclonal Antibody against TPD52L2
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SGDKPLSDPAP, from the C Terminus of the protein sequence according to NP_955392.1; NP_955393.1; NP_955394.1; NP_955395.1; NP_003279.2; NP_955391.1. |
Rabbit polyclonal anti-TPD54 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TPD54. |
Rabbit Polyclonal Anti-TPD52L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPD52L2 antibody is: synthetic peptide directed towards the middle region of Human TPD52L2. Synthetic peptide located within the following region: QVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA |
TPD52L2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TPD52L2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of Human TPD52L2 |
Active filters
Target Symbol
- TPD52L2