Antibodies

Jump to Filters
View as table Download
TPST2 Rabbit Polyclonal Antibody
TA336143

USD 375.00

5 Days

Rabbit Polyclonal Anti-TPST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TPST2 Antibody: synthetic peptide directed towards the middle region of human TPST2. Synthetic peptide located within the following region: KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL
TPST2 Rabbit Polyclonal Antibody
TA351844

USD 345.00

In Stock

Rabbit Polyclonal Anti-TPST2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TPST2