Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TRAF3IP3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRAF3IP3 |
Rabbit Polyclonal Anti-TRAF3IP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAF3IP3 antibody: synthetic peptide directed towards the middle region of human TRAF3IP3. Synthetic peptide located within the following region: KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS |
Rabbit Polyclonal Anti-TRAF3IP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAF3IP3 antibody: synthetic peptide directed towards the C terminal of human TRAF3IP3. Synthetic peptide located within the following region: DLQDQLKRSEAEKLTLVTRVQQLQGLLQNQSLQLQEQEKLLTKKDQALPV |
Anti-TRAF3IP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 240-436 amino acids of human TRAF3 interacting protein 3 |
Active filters
Target Symbol
- TRAF3IP3