Rabbit Polyclonal Anti-TRIM22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM22 antibody: synthetic peptide directed towards the N terminal of human TRIM22. Synthetic peptide located within the following region: LANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQ |
Rabbit Polyclonal Anti-TRIM22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM22 antibody: synthetic peptide directed towards the middle region of human TRIM22. Synthetic peptide located within the following region: VDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYW |
Carrier-free (BSA/glycerol-free) TRIM22 mouse monoclonal antibody, clone OTI2G2 (formerly 2G2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIM22 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TRIM22 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TRIM22 |
USD 509.00
5 Days
TRIM22 mouse monoclonal antibody, clone OTI2G2 (formerly 2G2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TRIM22 mouse monoclonal antibody,clone 2G2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TRIM22 mouse monoclonal antibody,clone 2G2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TRIM22 mouse monoclonal antibody, clone OTI2G2 (formerly 2G2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
5 Days
TRIM22 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TRIM22 mouse monoclonal antibody,clone 1A10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TRIM22 mouse monoclonal antibody,clone 1A10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TRIM22 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
