Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRIM23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM23 antibody: synthetic peptide directed towards the N terminal of human TRIM23. Synthetic peptide located within the following region: CPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISG |
Rabbit Polyclonal Anti-TRIM23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM23 antibody: synthetic peptide directed towards the middle region of human TRIM23. Synthetic peptide located within the following region: KHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQI |
Rabbit Polyclonal Anti-TRIM23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM23 antibody: synthetic peptide directed towards the C terminal of human TRIM23. Synthetic peptide located within the following region: RISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKL |
TRIM23 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM23 |
TRIM23 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TRIM23 (NP_001647.1). |
| Modifications | Unmodified |
TRIM23 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TRIM23