Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the N terminal of human TRIM29. Synthetic peptide located within the following region: EAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAA |
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: SLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP |
Rabbit polyclonal anti-ATDC antibody
| Applications | WB |
| Reactivities | Bovine, Chimpanzee, Human, Macaque, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit polyclonal ATDC Ac-K116 antibody
| Applications | WB |
| Reactivities | Bovine, Chimpanzee, Human, Macaque, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116. |
Rabbit polyclonal TRIM29 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TRIM29 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human TRIM29. |
Rabbit Polyclonal Anti-TRIM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: HKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKS |
TRIM29 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM29 |
TRIM29 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 309-588 of human TRIM29 (NP_036233.2). |
| Modifications | Unmodified |
TRIM29 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 309-588 of human TRIM29 (NP_036233.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
TRIM29 mouse monoclonal antibody,clone OTI5C11
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- TRIM29