Rabbit Polyclonal Anti-TRIM31 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM31 antibody: synthetic peptide directed towards the middle region of human TRIM31. Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG |
Rabbit Polyclonal Anti-TRIM31 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM31 antibody: synthetic peptide directed towards the N terminal of human TRIM31. Synthetic peptide located within the following region: CRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHR |
Rabbit Polyclonal Anti-DYDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYDC1 antibody: synthetic peptide directed towards the middle region of human DYDC1. Synthetic peptide located within the following region: EDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQD |
Rabbit Polyclonal Anti-TRIM31 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM31 |
TRIM31 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM31 |
TRIM31 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-425 of human TRIM31 (NP_008959.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
