Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY |
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK |
TRIM32 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TRIM32 (NP_036342.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
