Antibodies

Jump to Filters
View as table Download
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA345468

USD 475.00

5 Days

Rabbit Polyclonal Anti-TRIM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM5 antibody: synthetic peptide directed towards the N terminal of human TRIM5. Synthetic peptide located within the following region: CQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANLVEKLREVK
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA306153

USD 430.00

In Stock

Rabbit Polyclonal TRIM5 alpha Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM5 alpha antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of rhesus monkey TRIM5 alpha.
TRIM5 alpha (TRIM5) (C-term) Rabbit Polyclonal Antibody
AP22859PU-N

USD 525.00

2 Weeks

TRIM5 alpha (TRIM5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen TRIM5 antibody was raised against synthetic peptide
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA306150

USD 430.00

5 Days

Rabbit Polyclonal TRIM5 gamma Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM5 gamma antibody was raised against a synthetic peptide corresponding to 15 amino acids near the carboxy-terminus of human TRIM5 gamma.
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA306151

USD 430.00

5 Days

Rabbit Polyclonal TRIM5 delta Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM5 delta antibody was raised against a synthetic peptide corresponding to 13 amino acids near the carboxy-terminus of human TRIM5 delta.
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA306152

USD 430.00

5 Days

Rabbit Polyclonal TRIM5 alpha Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM5 alpha antibody was raised against a synthetic peptide corresponding to amino acids near the mid-region of human TRIM5 alpha.
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
AP22936PU-N

USD 440.00

2 Weeks

TRIM5 alpha (TRIM5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Monkey
Immunogen TRIM5 antibody was raised against synthetic peptide - KLH conjugated
TRIM5 alpha (TRIM5) Goat Polyclonal Antibody
TA302865

USD 375.00

5 Days

Goat Polyclonal Antibody against TRIM5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ASGILVNVKEEVTC, from the N Terminus of the protein sequence according to NP_149023.1; NP_149083.1; NP_149084.1.
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA306154

USD 430.00

5 Days

Rabbit Polyclonal TRIM5 alpha Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM5 alpha antibody was raised against a synthetic peptide corresponding to amino acids near the mid-region of rhesus monkey TRIM5 alpha.
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA382831

USD 220.00

3 Weeks

TRIM5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 (NP_149083.2).
TRIM5 alpha (TRIM5) Rabbit Polyclonal Antibody
TA382832

USD 220.00

3 Weeks

TRIM5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 (NP_149083.2).
Modifications Unmodified