Rabbit Polyclonal Anti-TRIM68 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM68 antibody: synthetic peptide directed towards the middle region of human TRIM68. Synthetic peptide located within the following region: VIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGS |
Rabbit Polyclonal Anti-TRIM68 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM68 Antibody: synthetic peptide directed towards the C terminal of human TRIM68. Synthetic peptide located within the following region: RLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDISFYNVTDCGSHI |
Rabbit Polyclonal Anti-TRIM68 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM68 Antibody: synthetic peptide directed towards the middle region of human TRIM68. Synthetic peptide located within the following region: EPISLELKTDCRVLGLREILKTYAADVRLDPDTAYSRLIVSEDRKRVHYG |
Germany
Japan
United Kingdom
China
