Antibodies

View as table Download

Rabbit polyclonal Anti-TRIML2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIML2 antibody: synthetic peptide directed towards the middle region of human TRIML2. Synthetic peptide located within the following region: SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT

Rabbit polyclonal Anti-TRIML2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIML2 antibody: synthetic peptide directed towards the middle region of human TRIML2. Synthetic peptide located within the following region: TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVS