Antibodies

Jump to Filters
View as table Download
Cip4 (TRIP10) Rabbit Polyclonal Antibody
TA335755

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: QEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAE
Cip4 (TRIP10) Rabbit Polyclonal Antibody
TA335756

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: ENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAE
Cip4 (TRIP10) Rabbit Polyclonal Antibody
TA343450

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10. Synthetic peptide located within the following region: FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
Cip4 (TRIP10) Rabbit Polyclonal Antibody
TA382843

USD 275.00

3 Weeks

TRIP10 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 246-545 of human TRIP10 (NP_004231.1).
Modifications Unmodified