Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: QEMKQERKMHFQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAE |
Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIP10 Antibody: synthetic peptide directed towards the N terminal of human TRIP10. Synthetic peptide located within the following region: ENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAE |
Rabbit Polyclonal Anti-TRIP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10. Synthetic peptide located within the following region: FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL |
TRIP10 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 246-545 of human TRIP10 (NP_004231.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China