Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIP13 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 Antibody: A synthesized peptide derived from human TRIP13

TRIP13 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 370-400 amino acids from the C-terminal region of human TRIP13

Rabbit Polyclonal Anti-TRIP13 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13. Synthetic peptide located within the following region: KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEF

Rabbit polyclonal anti-TRIP13 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TRIP13.

Rabbit Polyclonal Anti-TRIP13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13. Synthetic peptide located within the following region: MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHN

Rabbit Polyclonal Anti-TRIP13 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the C terminal of human TRIP13. Synthetic peptide located within the following region: LSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDKQFEERKKLAAYI

Carrier-free (BSA/glycerol-free) TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIP13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human TRIP13 (NP_004228.1).
Modifications Unmodified

TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

TRIP13 mouse monoclonal antibody,clone OTI2F5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated