Antibodies

View as table Download

Rabbit Polyclonal Anti-RG9MTD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RG9MTD2 antibody: synthetic peptide directed towards the middle region of human RG9MTD2. Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

TRMT10A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRMT10A