Rabbit Polyclonal Anti-CXorf34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXorf34 antibody: synthetic peptide directed towards the N terminal of human CXorf34. Synthetic peptide located within the following region: PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA |
Rabbit Polyclonal Anti-CXorf34 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXorf34 antibody: synthetic peptide directed towards the middle region of human CXorf34. Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA |
TRMT2B Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human TRMT2B (NP_079193.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
