Antibodies

Jump to Filters
View as table Download
TRPM2 Rabbit Polyclonal Antibody
TA308572

USD 415.00

5 Days

Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759)
TRPM2 Rabbit Polyclonal Antibody
TA335274

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
Trpm2 Rabbit Polyclonal Antibody
TA328746

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPM2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HTFQGKEWDPKKHVQE, corresponding to amino acid residues 105-120 of mouse TRPM2. Intracellular, N-terminus.
TRPM2 Rabbit Polyclonal Antibody
TA336551

USD 424.00

5 Days

Rabbit Polyclonal TRPM2 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the rat TRPM2 protein (within residues 1430-1508). [Swiss-Prot# Q5G856]
TRPM2 Rabbit Polyclonal Antibody
TA336554

USD 424.00

5 Days

Rabbit Polyclonal TRPM2 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the mouse TRPM2 protein (within residues 1200-1300). [Swiss-Prot# Q91YD4]
TRPM2 (1139-1150) Goat Polyclonal Antibody
AP23104PU-N

USD 440.00

2 Weeks

TRPM2 (1139-1150) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from internal region of human TRPM2 (NP_003298.1)
TRPM2 Rabbit Polyclonal Antibody
TA350548

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRPM2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM2
TRPM2 Rabbit Polyclonal Antibody
TA365105

USD 380.00

4 Weeks

TRPM2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRPM2
TRPM2 Rabbit Polyclonal Antibody
TA382869

USD 275.00

3 Weeks

TRPM2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TRPM2 (NP_003298.1).
Modifications Unmodified