Antibodies

Jump to Filters
View as table Download
TRPV6 Rabbit Polyclonal Antibody
TA371711

USD 380.00

4 Weeks

TRPV6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPV6
TRPV6 Rabbit Polyclonal Antibody
TA328645

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPV6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NRGLEDGESWEYQI, corresponding to amino acid residues 712-725 of human TRPV6.Intracellular, C-terminus.
TRPV6 Rabbit Polyclonal Antibody
TA590262

USD 409.00

In Stock

Rabbit Polyclonal TRPV6 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
TRPV6 Rabbit Polyclonal Antibody
TA338585

USD 375.00

5 Days

Rabbit Polyclonal Anti-Trpv6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC
TRPV6 Rabbit Polyclonal Antibody
TA367481

USD 380.00

4 Weeks

TRPV6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPV6
TRPV6 Rabbit Polyclonal Antibody
TA382879

USD 275.00

3 Weeks

TRPV6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRPV6 (NP_061116.5).
Modifications Unmodified