Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 44 of 44 results

(reset)

TSC22D1 Rabbit Polyclonal Antibody

TA312827

USD 345.00

In Stock

Rabbit polyclonal anti-TSC22D1 antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TSC22D1.

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Rabbit Polyclonal Antibody

TA337294

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSC22D1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TSC22D1 antibody: synthetic peptide directed towards the middle region of human TSC22D1. Synthetic peptide located within the following region: EQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGT

TSC22D1 Rabbit Polyclonal Antibody

TA343576

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSC22D1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TSC22D1 antibody: synthetic peptide directed towards the middle region of human TSC22D1. Synthetic peptide located within the following region: ASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKEL

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF505047

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1A5]

CF505048

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B10]

CF505058

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

CF505060

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

CF505061

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]

CF505062

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

CF505063

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]

CF505064

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TSC22D1 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Rabbit Polyclonal Antibody

TA350551

USD 345.00

In Stock

Rabbit Polyclonal Anti-TSC22D1 Antibody

Applications	IHC
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 2

2 / 2

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA505047

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]

TA505047AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 1G1, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

TA505047BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 1G1, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA505047S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1A5]

TA505048

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

TA505048AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 1A5, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]

TA505048BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 1A5, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI1A5]

TA505048S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B10]

TA505058

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B10]

TA505058AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 3B10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]

TA505058BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 3B10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B10]

TA505058S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI3B10 (formerly 3B10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

TA505060

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]

TA505060AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 2G3, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G3]

TA505060BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 2G3, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

TA505060S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA505061

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A11]

TA505061AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4A11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

TA505061BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4A11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA505061S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]

TA505062

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H8]

TA505062AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4H8, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H8]

TA505062BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4H8, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4H8]

TA505062S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

TA505063

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B7]

TA505063AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 3B7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B7]

TA505063BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 3B7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI3B7]

TA505063S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI3B7 (formerly 3B7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]

TA505064

USD 379.00

In Stock

TSC22D1 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F1]

TA505064AM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4F1, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F1]

TA505064BM

USD 420.00

5 Days

TSC22D1 mouse monoclonal antibody,clone 4F1, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TSC22D1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]

TA505064S

USD 159.00

2 Days

TSC22D1 mouse monoclonal antibody, clone OTI4F1 (formerly 4F1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 44 of 44 results