Rabbit Polyclonal Anti-TSPAN12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12. Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ |
TSPAN12 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TSPAN12 |
Rabbit Polyclonal Anti-TSPAN12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12. Synthetic peptide located within the following region: DSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGI |
Germany
Japan
United Kingdom
China