TSPAN2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 116~145 amino acids from the Center region of human TSPAN2 |
TSPAN2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 116~145 amino acids from the Center region of human TSPAN2 |
TSPAN2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TSPAN2 |
Rabbit Polyclonal Anti-TSPAN2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TSPAN2 antibody: synthetic peptide directed towards the middle region of human TSPAN2. Synthetic peptide located within the following region: FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS |