Antibodies

Jump to Filters
View as table Download
TSPAN2 (Center) Rabbit Polyclonal Antibody
AP54377PU-N

USD 450.00

2 Weeks

TSPAN2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 116~145 amino acids from the Center region of human TSPAN2
TSPAN2 (N-term) Rabbit Polyclonal Antibody
AP54378PU-N

USD 450.00

2 Weeks

TSPAN2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human TSPAN2
TSPAN2 Rabbit Polyclonal Antibody
TA339024

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSPAN2 antibody: synthetic peptide directed towards the middle region of human TSPAN2. Synthetic peptide located within the following region: FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS