Antibodies

Jump to Filters
View as table Download
TSPAN3 Rabbit Polyclonal Antibody
TA339023

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSPAN3 antibody: synthetic peptide directed towards the middle region of human TSPAN3. Synthetic peptide located within the following region: SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG
TSPAN3 Rabbit Polyclonal Antibody
TA382901

USD 220.00

3 Weeks

TSPAN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 105-210 of human TSPAN3 (NP_005715.1).
Modifications Unmodified