Rabbit Polyclonal Anti-TSPAN32 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN32 antibody: synthetic peptide directed towards the middle region of human TSPAN32. Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR |
Goat Polyclonal Antibody against TSPAN32
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GGLSGCPERGLSD, from the C Terminus of the protein sequence according to NP_620591.1; NP_005696.1. |
Rabbit Polyclonal Anti-TSPAN32 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN32 antibody: synthetic peptide directed towards the middle region of human TSPAN32. Synthetic peptide located within the following region: EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD |
Germany
Japan
United Kingdom
China
