Antibodies

Jump to Filters
View as table Download
TSPAN5 Rabbit Polyclonal Antibody
TA339022

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSPAN5 antibody: synthetic peptide directed towards the middle region of human TSPAN5. Synthetic peptide located within the following region: ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
TSPAN5 Goat Polyclonal Antibody
TA311341

USD 375.00

5 Days

Goat Anti-TSPAN5 / NET-4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence SGKHYKGPEVSC, from the N Terminus of the protein sequence according to NP_005714.2.