Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TTC23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTC23 Antibody: A synthesized peptide derived from human TTC23 |
Antibodies
View as table Download
Rabbit polyclonal anti-TTC23 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TTC23. |
Rabbit Polyclonal Anti-TTC23 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TTC23 antibody is: synthetic peptide directed towards the C-terminal region of Human TTC23. Synthetic peptide located within the following region: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP |
Rabbit Polyclonal Anti-TTC23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TTC23 |
TTC23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TTC23 |
TTC23 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TTC23 |
Active filters
Target Symbol
- TTC23