Rabbit Polyclonal Anti-Ttf1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ttf1 antibody: synthetic peptide directed towards the n terminal of mouse Ttf1. Synthetic peptide located within the following region: RRASQTPAQETLESEWPQKAKRKKRRREPQTPAQETLESEWPQKAKKKKR |
Rabbit Polyclonal Anti-TTF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTF1 antibody: synthetic peptide directed towards the middle region of human TTF1. Synthetic peptide located within the following region: KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN |
Germany
Japan
United Kingdom
China
