Antibodies

View as table Download

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 91-105 amino acids of human thioredoxin

TXN rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen TXN antibody was raised against recombinant human protein purified from E. coli.

Rabbit polyclonal TXN Antibody (C-term)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Pig, Rabbit)
Conjugation Unconjugated
Immunogen This TXN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-94 amino acids from the C-terminal region of human TXN.

Rabbit Polyclonal Anti-TXN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TXN antibody is: synthetic peptide directed towards the C-terminal region of Human TXN. Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 90-105 amino acids of human thioredoxin

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 90-105 amino acids of human thioredoxin

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 91-105 amino acids of human thioredoxin

TXN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TXN

TXN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human TXN

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified