Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TXN Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TXN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-94 amino acids from the C-terminal region of human TXN. |
Rabbit Polyclonal Anti-TXN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TXN antibody is: synthetic peptide directed towards the C-terminal region of Human TXN. Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT |
Anti-TXN Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 90-105 amino acids of human thioredoxin |
TXN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TXN |
TXN Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human TXN |
Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2). |
| Modifications | Unmodified |
Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2). |
| Modifications | Unmodified |
Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TXN