Rabbit Polyclonal Anti-TXN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXN2 antibody: synthetic peptide directed towards the middle region of human TXN2. Synthetic peptide located within the following region: QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ |
Rabbit Polyclonal Anti-TXN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXN2 antibody: synthetic peptide directed towards the middle region of human TXN2. Synthetic peptide located within the following region: VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI |
Thioredoxin 2 (Trx2/TXN2) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2). |
| Modifications | Unmodified |
Thioredoxin 2 (Trx2/TXN2) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human Thioredoxin 2 (Trx2/Thioredoxin 2 (Trx2/TXN2)) (NP_036605.2). |
| Modifications | Unmodified |
Thioredoxin 2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Thioredoxin 2 |
Germany
Japan
United Kingdom
China
