Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Rabbit Polyclonal TXNIP Antibody
| Applications | WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 100-150 of human TxNIP was used as the immunogen. |
Rabbit Polyclonal Anti-TXNIP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TXNIP antibody: synthetic peptide directed towards the C terminal of human TXNIP. Synthetic peptide located within the following region: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP |
Rabbit Polyclonal Anti-TXNIP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TXNIP |
TXNIP Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNIP |
TXNIP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TXNIP |
TXNIP Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human TXNIP (NP_006463.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
