Rabbit Polyclonal Anti-TAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAC3 antibody: synthetic peptide directed towards the middle region of human TAC3. Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF |
Neurokinin B, rabbit anti Neurokinin B, polyclonal.
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Neurokinin B; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2 coupled to carrier protein. |
Germany
Japan
United Kingdom
China
