Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TAF15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF15 antibody: synthetic peptide directed towards the N terminal of human TAF15. Synthetic peptide located within the following region: HQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDN |
Rabbit Polyclonal Anti-TAF15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF15 antibody: synthetic peptide directed towards the N terminal of human TAF15. Synthetic peptide located within the following region: PDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYS |
Rabbit Polyclonal anti-TAF15 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF15 antibody: synthetic peptide directed towards the N terminal of human TAF15. Synthetic peptide located within the following region: TDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQN |
Mouse Monoclonal TAF15 Antibody (4D71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-TAF15 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF15 antibody: synthetic peptide directed towards the N terminal of human TAF15. Synthetic peptide located within the following region: GGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSD |
Rabbit Polyclonal Anti-TAF15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TAF15 |
TAF15 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TAF15 (NP_631961.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TAF15