Rabbit Polyclonal Anti-TANGO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANGO2 antibody: synthetic peptide directed towards the N terminal of human TANGO2. Synthetic peptide located within the following region: MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL |
Rabbit Polyclonal Anti-TANGO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANGO2 antibody is: synthetic peptide directed towards the middle region of Human TANGO2. Synthetic peptide located within the following region: LDWQARGRGTYGLSNALLETPWRKLCFGKQLFLEAVERSQALPKDVLIAS |
Germany
Japan
United Kingdom
China