Germany
Japan
United Kingdom
China
TAS1R1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 322-351 amino acids from the Central region of human TAS1R1 |
Antibodies
View as table Download
T1R1 / TAS1R1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | T1R1 / TAS1R1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (83%). |
T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit |
Rabbit Polyclonal Anti-TAS1R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT |
Rabbit Polyclonal Anti-TAS1R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP |
TAS1R1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 330-567 of human TAS1R1 (NP_619642.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TAS1R1