Rabbit Polyclonal TASP1 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TASP1 antibody: mouse human TASP1 (Threonine aspartase 1), using three KLH-conjugated synthetic peptides: two containing an amino acid sequence from the N-terminal part of the protein and one containing an amino acid sequence from t |
Rabbit Polyclonal Anti-TASP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TASP1 antibody: synthetic peptide directed towards the middle region of human TASP1. Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI |
Carrier-free (BSA/glycerol-free) TASP1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TASP1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TASP1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TASP1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TASP1 mouse monoclonal antibody, clone OTI1C12 (formerly 1C12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
