Antibodies

Jump to Filters
View as table Download
TBC1D24 Rabbit Polyclonal Antibody
TA344770

USD 475.00

5 Days

Rabbit Polyclonal Anti-TBC1D24 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBC1D24 antibody: synthetic peptide directed towards the middle region of human TBC1D24. Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL