Antibodies

View as table Download

Rabbit polyclonal TBX4 Antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TBX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 103-129 amino acids from the N-terminal region of human TBX4.

Rabbit Polyclonal Anti-TBX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX4 antibody: synthetic peptide directed towards the middle region of human TBX4. Synthetic peptide located within the following region: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE

Rabbit Polyclonal Anti-Tbx4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tbx4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tbx4. Synthetic peptide located within the following region: DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ

TBX4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBX4

TBX4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 296-545 of human TBX4 (NP_060958.2).
Modifications Unmodified