Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TESK2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TESK2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TESK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TESK2 antibody is: synthetic peptide directed towards the C-terminal region of Human TESK2. Synthetic peptide located within the following region: AHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFST |
TESK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 302-571 of human TESK2 (NP_009101.2). |
| Modifications | Unmodified |
TESK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 302-571 of human TESK2 (NP_009101.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TESK2