Antibodies

Jump to Filters
View as table Download
TEX2 Rabbit Polyclonal Antibody
TA331043

USD 375.00

5 Days

Rabbit polyclonal Anti-TEX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TEX2 antibody: synthetic peptide directed towards the N terminal of human TEX2. Synthetic peptide located within the following region: KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL
TEX2 Rabbit Polyclonal Antibody
TA382443

USD 220.00

3 Weeks

TEX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 915-1134 of human TEX2 (NP_060939.3).
Modifications Unmodified