Antibodies

Jump to Filters
View as table Download
EVER2 (TMC8) Rabbit Polyclonal Antibody
TA306575

USD 430.00

5 Days

Rabbit Polyclonal EVER2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EVER2 antibody was raised against a 14 amino acid peptide from near the center of human EVER2.
EVER2 (TMC8) Rabbit Polyclonal Antibody
AP22949PU-N

USD 440.00

2 Weeks

EVER2 (TMC8) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen TMC8 antibody was raised against 14 amino acid peptide from near the center of human EVER2
EVER2 (TMC8) Rabbit Polyclonal Antibody
TA306598

USD 430.00

5 Days

Rabbit Polyclonal EVER2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EVER2 antibody was raised against a 18 amino acid peptide from near the amino terminus of human EVER2.
EVER2 (TMC8) Rabbit Polyclonal Antibody
TA338861

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMC8 antibody: synthetic peptide directed towards the N terminal of human TMC8. Synthetic peptide located within the following region: PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG