Rabbit Polyclonal Anti-MGC4618 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM |
Rabbit Polyclonal Anti-MGC4618 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MGC4618 Antibody: synthetic peptide directed towards the N terminal of human MGC4618. Synthetic peptide located within the following region: QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLM |
Germany
Japan
United Kingdom
China