Antibodies

Jump to Filters
View as table Download
Tmem178 Rabbit Polyclonal Antibody
TA329555

USD 375.00

5 Days

Rabbit Polyclonal anti-Tmem178 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tmem178 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tmem178. Synthetic peptide located within the following region: PDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRSDPESWRSLLGLGGLDAE
Tmem178 Rabbit Polyclonal Antibody
TA363438

USD 360.00

5 Days

TMEM178 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse TMEM178