Antibodies

Jump to Filters
View as table Download
FAM70A (TMEM255A) Rabbit Polyclonal Antibody
TA342048

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM70A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM70A antibody: synthetic peptide directed towards the N terminal of human FAM70A. Synthetic peptide located within the following region: IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR
FAM70A (TMEM255A) Rabbit Polyclonal Antibody
TA360454

USD 360.00

5 Days

TMEM255A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM255A