C15ORF27 (TMEM266) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 506-535 amino acids from the C-terminal region of human CO027 |
C15ORF27 (TMEM266) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 506-535 amino acids from the C-terminal region of human CO027 |
Rabbit Polyclonal Anti-C15orf27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C15orf27 antibody: synthetic peptide directed towards the middle region of human C15orf27. Synthetic peptide located within the following region: EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA |
Rabbit Polyclonal Anti-C15orf27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C15orf27 antibody: synthetic peptide directed towards the middle region of human C15orf27. Synthetic peptide located within the following region: PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRS |