Antibodies

Jump to Filters
View as table Download
Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody
TA337827

USD 375.00

In Stock

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody
TA371934

USD 380.00

4 Weeks

TMPRSS6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMPRSS6
TMPRSS6 Rabbit Polyclonal Antibody
TA367706

USD 380.00

4 Weeks

TMPRSS6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMPRSS6