Antibodies

Jump to Filters
View as table Download
TNFAIP2 Rabbit Polyclonal Antibody
AP17795PU-N

USD 450.00

2 Weeks

TNFAIP2 rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 456-484 amino acids from the Central region of Human TNFAIP2.
TNFAIP2 Rabbit Polyclonal Antibody
TA314633

USD 345.00

In Stock

Rabbit polyclonal anti-TNAP2 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNAP2.
TNFAIP2 Rabbit Polyclonal Antibody
TA319723

USD 430.00

5 Days

Rabbit Polyclonal TNFAIP2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TNFAIP2 antibody was raised against a 19 amino acid synthetic peptide near the center of human TNFAIP2.
TNFAIP2 Rabbit Polyclonal Antibody
TA330914

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFAIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFAIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TNFAIP2. Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG
TNFAIP2 Rabbit Polyclonal Antibody
TA350526

USD 345.00

In Stock

Rabbit Polyclonal Anti-TNFAIP2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFAIP2
TNFAIP2 Rabbit Polyclonal Antibody
TA365087

USD 380.00

4 Weeks

TNFAIP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFAIP2