Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-Tnfrsf21 (DR6) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 622 of rat DR6 |
Antibodies
View as table Download
Rabbit Polyclonal DR6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DR6 antibody was raised against a peptide corresponding to amino acids 42 to 56 of human DR6 precursor . |
Rabbit Polyclonal Anti-TNFRSF21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
Anti-TNFRSF21 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 42-56 amino acids of Human tumor necrosis factor receptor superfamily, member 21 |
Active filters
Target Symbol
- TNFRSF21