Rabbit Polyclonal Anti-TNNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNNT1 antibody: synthetic peptide directed towards the middle region of human TNNT1. Synthetic peptide located within the following region: WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK |
Troponin T1 (TNNT1) mouse monoclonal antibody, clone TT-98, Purified
| Applications | IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Rabbit anti Troponin T Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to inter-segment of human Troponin T Cardiac isoform protein. |
TNNT1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TNNT1 |
TNNT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human TNNT1 (NP_001119604.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
