Antibodies

View as table Download

TOLLIP Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal TOLLIP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TOLLIP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human TOLLIP.

Rabbit Polyclonal TOLLIP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TOLLIP antibody was raised against a 16 amino acid peptide from near the center of human TOLLIP.

Rabbit polyclonal anti-TOLLIP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TOLLIP.

Rabbit Polyclonal anti-TOLLIP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOLLIP antibody: synthetic peptide directed towards the C terminal of human TOLLIP. Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG

Carrier-free (BSA/glycerol-free) TOLLIP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TOLLIP mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TOLLIP mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Tollip Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TOLLIP mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated