Antibodies

Jump to Filters
View as table Download
TOR1AIP2 Rabbit Polyclonal Antibody
TA331367

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOR1AIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TOR1AIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS